Comparison

Recombinant Bordetella pertussis Pertussis toxin subunit 1(ptxA)

Item no. CSB-EP356423BUA-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDH LTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQE AVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYF EYVDTYGDNAGRILAGALATYQSEYLAHRRIPPEN IRRVTRVYHNGITGETTTTEYSNARYVSQQTRANP NPYTSRRSVASIVGTLVRMAPVIGACMARQAESSE AMAAWSERAGEAMVLVYYESIAYSF
Protein Family Bacterial exotoxin subunit A family
Citations Mutations in the S1 subunit of pertussis toxin that affect secretion.Craig-Mylius K.A., Stenson T.H., Weiss A.A.Infect. Immun. 68:1276-1281(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Islet-activating protein S1 ;IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
30.2 kDa
Relevance
S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD+ into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their mbrane receptors.
Expression Region
35-269aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors.
Subcellular Location
Secreted
Gene Names
ptxA
Sequence Info
Full Length of Mature Protein
Organism
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close