« Back
Home /
Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Item no.	CSB-EP362349ENV-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLV VDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSN FSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPV ALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSD DFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDY PGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFT NTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGT SAV
Protein Family	Fimbrial protein family
Citations	Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Targets	fimH
Manufacturer - Conjugate / Tag	N-terminal 6xHis-GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.1 kDa
Relevance	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Expression Region	22-300aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Subcellular Location	Fimbrium
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP362349ENV-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer