« Back
Home /
Recombinant Clostridium botulinum Penicillin-binding protein 1A(pbpA),partial

Recombinant Clostridium botulinum Penicillin-binding protein 1A(pbpA),partial

Item no.	CSB-EP401992CWV-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTE YDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRR DYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSN TRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNN NNNNDNNNNTKPPENDSNQNHEDNKNKQ
Protein Family	Glycosyltransferase 51 family; Transpeptidase family
Citations	"Analysis of the neurotoxin complex genes in Clostridium botulinum A1-A4 and B1 strains: BoNT/A3, /Ba4 and /B1 clusters are located within plasmids." Smith T.J., Hill K.K., Foley B.T., Detter J.C., Munk A.C., Bruce D.C., Doggett N.A., Smith L.A., Marks J.D., Xie G., Brettin T.S. PLoS ONE 2:E1271-E1271(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Peptidoglycan TGase; DD-transpeptidase
Available
Manufacturer - Targets	pbpA
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.2 kDa
General Research Areas	Cell Biology
Relevance	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Expression Region	663-830aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP401992CWV-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer