« Back
Home /
Recombinant Porphyromonas gingivalis Lys-gingipain(kgp),partial

Recombinant Porphyromonas gingivalis Lys-gingipain(kgp),partial

Item no.	CSB-EP464342EXZ-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWK AQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDG LAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYY SAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYE KATMPDKSYLEKALLIAGADSYWNPKIGQQTIKYA VQYYYNQDHGYTDVYSYPKAPYTGCYSHLNTGVGF ANYTAHGSETSWADPSLTATQVKALTNKDKYFLAI GNC
Protein Family	Peptidase C25 family
Citations	"Biochemical and functional properties of lysine-specific cysteine proteinase (Lys-gingipain) as a virulence factor of Porphyromonas gingivalis in periodontal disease."Abe N., Kadowaki T., Okamoto K., Nakayama K., Ohishi M., Yamamoto K.J. Biochem. 123:305-312(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lysine-specific cysteine proteinase Kgp
Available
Manufacturer - Targets	kgp
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56.6 kDa
Relevance	Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P.gingivalis with other oral bacteria.
Expression Region	229-594aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P.gingivalis with other oral bacteria.
Subcellular Location	Lys-gingipain catalytic subunit: Secreted, extracellular space
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP464342EXZ-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer