« Back
Home /
Recombinant Microbacterium testaceum N-acyl homoserine lactonase(aiiM)

Recombinant Microbacterium testaceum N-acyl homoserine lactonase(aiiM)

Item no.	CSB-EP512020MTN-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MILAHDVSGSGPLLVLLHGITEDRRSWDPVDFTDG FTVVRVDLRGHGASAAEEPYDIPTLATDVHDTLAQ LAENDVIPGELPVIVGHSMGGIVATAYGALFPARA IVNVDQPLQLAGMQGQVQQAEGMLRGADFPLFIHG MFAQMAGGLDAEELARVNGIRSPRQDVVLGMWRPL LEDSPEELAALVSGLTRIPEDVPYLVITGLDAGPE YAAWLQREIPQAVQEVWQPPTHYPHLVDPARFVER VEA
Citations	"AiiM, a novel class of N-acylhomoserine lactonase from the leaf-associated bacterium Microbacterium testaceum."Wang W., Morohoshi T., Ikenoya M., Someya N., Ikeda T.Appl. Environ. Microbiol. 76:2524-2530(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AHL-lactonase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.3 kDa
Relevance	Hydrolyzes short- and long-chain N-acyl homoserine lactones with or without 3-oxo substitution at C3. Has slight activity towards L-homoserine lactone, and no activity towards gamma-butyrolactone.
Expression Region	1-251aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Hydrolyzes short- and long-chain N-acyl homoserine lactones with or without 3-oxo substitution at C3. Has slight activity towards L-homoserine lactone, and no activity towards gamma-butyrolactone.
Gene Names	aiiM
Sequence Info	Full Length
Organism	Microbacterium testaceum (strain StLB037)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP512020MTN-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time