« Back
Home /
Recombinant Streptomyces achromogenes Modification methylase SacI(sacIM)

Recombinant Streptomyces achromogenes Modification methylase SacI(sacIM)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP523234FNS-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	O31073
Gene Names	sacIM
Organism	Streptomyces achromogenes
AA Sequence	MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSG SPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQT IPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFW IEEKRNSADPNASLLDEYVRVVRESKPEAFILENV QGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAE YGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERD RVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYA ELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFL LKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEE RARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGN PVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHE QLELI
Expression Region	1-390aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	59.3 kDa
Alternative Name(s)	Cytosine-specific methyltransferase SacI
Relevance	This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.
Reference	Cloning and expression of the ApaLI, NspI, NspHI, SacI, ScaI, and SapI restriction-modification systems in Escherichia coli.Xu S.-Y., Xiao J.-P., Ettwiller L., Holden M., Aliotta J., Poh C.L., Dalton M., Robinson D.P., Petronzio T.R., Moran L., Ganatra M., Ware J., Slatko B., Benner J. IIMol. Gen. Genet. 260:226-231(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.
Protein Families	Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP523234FNS-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time