Comparison

Recombinant Porcine circovirus 2 Capsid protein(Cap)

Item no. CSB-EP530008EXT-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag Myc, SUMO, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHR YRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVD MMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEF WPCSPITQGDRGVGSTAVILDDNFVTKATALTYDP YVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQ PNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQD YNIRVTMYVQFREFNLKDPPLKP
Protein Family Circoviridae capsid protein family
Citations "Nucleotide sequence of porcine circovirus associated with postweaning multisystemic wasting syndrome in pigs."
Hamel A.L., Lin L.L., Nayar G.P.
J. Virol. 72:5262-5267(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
47.9 kDa
General Research Areas
Signal Transduction
Relevance
Self-assembles to form the virion icosahedral capsid with a T=1 symmetry. This very small capsid (17 - 22 nm in diameter) allows the virus to be very stable in the environment and resistant to some disinfectants, including detergents. Essential for the initial attachment to heparan sulfate moities and chondroitin sulfate B of the host cell surface proteoglycans. After attachment, the virus is internalized in a clathrin-, caveolae- and dynamin-independent, actin and Rho-GTPase-mediated pathway and traffics to the nucleus. The capsid protein binds and transports the viral genome and Rep across the nuclear envelope
Expression Region
1-233aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Self-assembles to form the virion icosahedral capsid with a T=1 symmetry. This very small capsid (17 - 22 nm in diameter) allows the virus to be very stable in the environment and resistant to some disinfectants, including detergents. Essential for the initial attachment to heparan sulfate moities and chondroitin sulfate B of the host cell surface proteoglycans. After attachment, the virus is internalized in a clathrin-, caveolae- and dynamin-independent, actin and Rho-GTPase-mediated pathway and traffics to the nucleus. The capsid protein binds and transports the viral genome and Rep across the nuclear envelope (By similarity).
Subcellular Location
Host nucleus, Virion
Gene Names
Cap
Sequence Info
Full Length
Organism
Porcine circovirus 2 (PCV2)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close