« Back
Home /
Recombinant Halobacterium salinarum Cobalamin-binding protein(btuF)

Recombinant Halobacterium salinarum Cobalamin-binding protein(btuF)

Item no.	CSB-EP534746HTL-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	LAPQPPAQHADADRACSFPVTEPDASNTAITLDSE PERVVTLNPSAAQTMWELGDRDAVVGVSQFGTYLP TASQRTVVSGGQPSQTNVEAVVGLDPDLVLAPNTV RNTTVTRLRSAGITVFQFRAATSIDGVVEKTATIG RLTGNCAAAAATTAEMRDRVAAIADAVPDTDSARP RVYYHLGDGYTAGPNTFIGAAIEAAGGHNIAADVN TTSSYPQLSEEVIVSQDPDVVVTGVSADRLDATAS ALV
Citations	Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1. Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp A., Soppa J., Tittor J., Oesterhelt D. Genomics 91:335-346(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Vitamin B12-binding protein
Available
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.3 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably binds cobalamin and delivers it to the surface of BtuC.
Expression Region	25-369aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably binds cobalamin and delivers it to the surface of BtuC (By similarity).
Gene Names	btuF
Sequence Info	Full Length of Mature Protein
Organism	Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP534746HTL-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer