« Back
Home /
Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD(btuD)

Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD(btuD)

Item no.	CSB-EP538512HTLb0-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVG PNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALS SAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHT TRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGG ERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRT LEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVV ADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPA TGA
Protein Family	ABC transporter superfamily
Citations	"Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1." Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp A., Soppa J., Tittor J., Oesterhelt D. Genomics 91:335-346(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Vitamin B12-transporting ATPase
Available
Manufacturer - Targets	btuD
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.9 kDa
Relevance	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably responsible for energy coupling to the transport system.
Expression Region	1-398aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity).
Subcellular Location	Cell membrane, Peripheral membrane protein
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP538512HTLb0-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer