Comparison

Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5(MPK5)

Item no. CSB-EP607476OFG-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKY QPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANA FNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPP IPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQ YFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCD LKICDFGLARPSSESDMMTEYVVTRWYRAPELLLN STDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQ MRL
Protein Family Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Citations "Isolation of novel rice (Oryza sativa L.) multiple stress responsive MAP kinase gene, OsMSRMK2, whose mRNA accumulates rapidly in response to environmental cues."
Agrawal G.K., Rakwal R., Iwahashi H.
Biochem. Biophys. Res. Commun. 294:1009-1016(2002)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Benzothiadiazole-induced MAP kinase 1; MAP kinase 2; Multiple stress-responsive MAP kinase 2; OsBIMK1; OsMAP1; OsMAPK2; OsMAPK5; OsMPK3; OsMSRMK2; BIMK1, MAPK2, MAPK5, MPK3, MSRMK2
Available
Manufacturer - Targets
MPK5
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
48.0 kDa
Relevance
Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance. Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation
Expression Region
1-369aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance
Subcellular Location
Nucleus, Cytoplasm
Tissue Specificity
Expressed in roots, stems and panicles, and at lower levels in leaves.
Biologically active
Not Test
Protein length
Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close