« Back
Home /
Recombinant Mycoplasma pneumoniae Methionine aminopeptidase(map)

Recombinant Mycoplasma pneumoniae Methionine aminopeptidase(map)

Item no.	CSB-EP608941MLW-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGK SLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLS LNETVIHGIADNRVFGVKDKLTLDIGINLNGYICD AAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRP NNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKV HEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSD AMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFEC LTN
Protein Family	Peptidase M24A family, Methionine aminopeptidase type 1 subfamily
Citations	"Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:MAPUniRule annotation; Short name:MetAPUniRule annotation; Alternative name(s):; Peptidase M
Available
Manufacturer - Targets	map
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.7 kDa
General Research Areas	Cell Biology
Relevance	Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Expression Region	1-248aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP608941MLW-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer