« Back
Home /
Recombinant Human Growth-regulated alpha protein(CXCL1)

Recombinant Human Growth-regulated alpha protein(CXCL1)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-EP609HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P09341
Gene Names	CXCL1
Organism	Homo sapiens (Human)
AA Sequence	ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHC AQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSD KSN
Expression Region	35-107aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	23.9 kDa
Alternative Name(s)	C-X-C motif chemokine 1 GRO-alpha(1-73) Melanoma growth stimulatory activity Short name: MGSA Neutrophil-activating protein 3 Short name: NAP-3
Relevance	Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Reference	"Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin."Richmond A., Balentien E., Thomas H.G., Flaggs G., Barton D.E., Spiess J., Bordoni R., Francke U., Derynck R.EMBO J. 7:2025-2033(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP609HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time