« Back
Home /
Recombinant Human Membrane-bound transcription factor site-1 protease(MBTPS1),partial

Recombinant Human Membrane-bound transcription factor site-1 protease(MBTPS1),partial

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP617930HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q14703
Gene Names	MBTPS1
Organism	Homo sapiens (Human)
AA Sequence	DTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTF VAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTS WFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKV WELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIG VGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIV TYGAGVRGSGVKGGCRALSGTS
Expression Region	218-414aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	37.5 kDa
Alternative Name(s)	Endopeptidase S1P Subtilisin/kexin-isozyme 1 Short name: SKI-1
Relevance	Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes.
Reference	"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes.
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein
Protein Families	Peptidase S8 family
Tissue Specificity	Widely expressed.
Paythway	Proteinprocessinginendoplasmicreticulum
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time