« Back
Home /
Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Item no.	CSB-EP618634HU1-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISV MVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQ NPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKL DAFIYDAAVLNYKAGRDEGCKLVTI
Protein Family	Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily
Citations	Mutations in GRIN2A and GRIN2B encoding regulatory subunits of NMDA receptors cause variable neurodevelopmental phenotypes.Endele S., Rosenberger G., Geider K., Popp B., Tamer C., Stefanova I., Milh M., Kortum F., Fritsch A., Pientka F.K., Hellenbroich Y., Kalscheuer V.M., Kohlhase J., Moog U., Rappold G., Rauch A., Ropers H.H., von Spiczak S. , Tonnies H., Villeneuve N., Villard L., Zabel B., Zenker M., Laube B., Reis A., Wieczorek D., Van Maldergem L., Kutsche K.Nat. Genet. 42:1021-1026(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A ;NMDAR2A ;NR2A ;hNR2A
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	18.2 kDa
General Research Areas	Transport
Relevance	NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
Expression Region	23-555aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+)
Subcellular Location	Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein
Involvement in disease	Epilepsy, focal, with speech disorder and with or without mental retardation (FESD)
Paythway	Calciumsignalingpathway
Gene Names	GRIN2A
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP618634HU1-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer