Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Item no. |
CSB-EP618885HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q14344 |
Gene Names |
GNA13 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEID KCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRI IHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREK LHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETR VFLQYLPAIRALWADSGIQNAYDRRREFQLGESVK YFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD FEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILF LVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRV FSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGD PHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI NTENIRLVFRDVKDTILHDNLKQLMLQ |
Expression Region |
1-377aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
48.0 kDa |
Relevance |
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF1/p115RhoGEF, ARHGEF11/PDZ-RhoGEF and ARHGEF12/LARG). GNA13-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1).Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation |
Reference |
"Leukemia-associated Rho guanine nucleotide exchange factor (LARG) links heterotrimeric G proteins of the G(12) family to Rho." Fukuhara S., Chikumi H., Gutkind J.S. FEBS Lett. 485:183-188(2000) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems |
Subcellular Location |
Cell membrane, Lipid-anchor, Melanosome, Cytoplasm, Nucleus |
Protein Families |
G-alpha family, G(12) subfamily |
Tissue Specificity |
Expressed in testis, including in Leydig cells and in the seminiferous epithelium, in differentiating cells from the spermatogonia to mature spermatozoa stages and round spermatids (at protein level). Expressed in 99.2% of spermatozoa from healthy individuals, but only in 28.6% of macrocephalic spermatozoa from infertile patients (at protein level). |
Paythway |
Regulationofactincytoskeleton |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.