« Back
Home /
Recombinant Human Oligodendrocyte transcription factor 2(OLIG2)

Recombinant Human Oligodendrocyte transcription factor 2(OLIG2)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP623814HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q13516
Gene Names	OLIG2
Organism	Homo sapiens (Human)
AA Sequence	MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFT GGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPE LQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSE IYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPG SGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSL PRLTSDAK
Expression Region	1-323aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	48.4 kDa
Alternative Name(s)	Class B basic helix-loop-helix protein 1 Short name: bHLHb1 Class E basic helix-loop-helix protein 19 Short name: bHLHe19 Protein kinase C-binding protein 2 Protein kinase C-binding protein RACK17
Relevance	Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development
Reference	"Protein kinase C-binding protein."Kuroda S., Tokunaga C., Kiyohara Y., Konishi H., Kikkawa U.Submitted (FEB-1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development (By similarity).
Involvement in disease	A chromosomal aberration involving OLIG2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(14; 21)(q11.2; q22) with TCRA.
Subcellular Location	Nucleus, Cytoplasm
Tissue Specificity	Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP623814HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time