« Back
Home /
Recombinant Human Core-binding factor subunit beta(CBFB)

Recombinant Human Core-binding factor subunit beta(CBFB)

Item no.	CSB-EP623835HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDR PHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNG VCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVT GKKTTRP
Protein Family	CBF-beta family
Citations	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Polyomavirus enhancer-binding protein 2 beta subunit ,PEA2-beta ,PEBP2-beta,SL3-3 enhancer factor 1 subunit beta,SL3/AKV core-binding factor beta subunit
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.5 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
Expression Region	1-182aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
Subcellular Location	Nucleus
Involvement in disease	A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13; q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
Gene Names	CBFB
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP623835HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer