« Back
Home /
Recombinant Mouse Thyroid hormone-inducible hepatic protein(Thrsp)

Recombinant Mouse Thyroid hormone-inducible hepatic protein(Thrsp)

Manufacturer	Cusabio
Category	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Thyroid Cancer Other Lipid\Cholesterol Metabolism Modulators
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP726789MO-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Signal Transduction
Uniprot ID	Q62264
Gene Names	Thrsp
Organism	Mus musculus (Mouse)
AA Sequence	MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPS LLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEV DHGLLPREEWQAKVAGNETSEAENDAAETEEAEED RISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTR KYQEMTGQVL
Expression Region	1-150aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	33.1 kDa
Alternative Name(s)	Spot 14 protein Short name: S14 Short name: SPOT14
Relevance	Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB
Reference	Cloning and initial characterization of human and mouse Spot 14 genes.Grillasca J.-P., Gastaldi M., Khiri H., Dace A., Peyrol N., Reynier P., Torresani J., Planells R.FEBS Lett. 401:38-42(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB (By similarity).
Subcellular Location	Nucleus, Cytoplasm
Protein Families	SPOT14 family
Tissue Specificity	Mainly expressed in tissues that synthesize triglycerides.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP726789MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time