Comparison

Recombinant Human Dual specificity protein phosphatase 13 isoform MDSP(DUSP13)

Item no. CSB-EP734923HU-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAETSLPELGGEDKATPCPSILELEELLRAGKSSC SRVDEVWPNLFIGDAATANNRFELWKLGITHVLNA AHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISA YFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLV LAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQL CRLDQQLRGAGQS
Protein Family Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Citations Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2.Chen H.-H., Luche R., Wei B., Tonks N.K.J. Biol. Chem. 279:41404-41413(2004)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Branching-enzyme interacting DSPMuscle-restricted DSP ,MDSP
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
36.7 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Signal Transduction
Relevance
Probable protein tyrosine phosphatase. Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by AKT1. Shows no phosphatase activity on MAPK1/ERK2, MAPK8/JNK, MAPK14/p38 and MAP3K5/ASK1.
Expression Region
1-198aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Probable protein tyrosine phosphatase. Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by AKT1. Shows no phosphatase activity on MAPK1/ERK2, MAPK8/JNK, MAPK14/p38 and MAP3K5/ASK1.
Subcellular Location
Cytoplasm
Tissue Specificity
Skeletal muscle specific.
Gene Names
DUSP13
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close