Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP745333HU-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Others |
Target / Protein |
EIF3M |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
Q7L2H7 |
AA Sequence |
SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEG GLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLL LILEPDKQEALIESLCEKLVKFREGERPSLRLQLL SNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIP TELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCK KSDAASKVMVELLGSYTEDNASQARVDAHRCIVRA LKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVS AKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLT FMGMAVENKEISFDTMQQELQIGADDVEAFVIDAV RTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLY DTLNAWKQNLNKVKNSLLSLSDT |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-374aa |
Protein length |
Full Length of Mature Protein |
MW |
58.4 kDa |
Alternative Name(s) |
Short name: eIF3m Alternative name(s): Fetal lung protein B5 Short name: hFL-B5 PCI domain-containing protein 1 |
Relevance |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2). |
References |
"A new class of receptor for herpes simplex virus has heptad repeat motifs that are common to membrane fusion proteins."Perez A., Li Q.-X., Perez-Romero P., DeLassus G., Lopez S.R., Sutter S., McLaren N., Fuller A.O.J. Virol. 79:7419-7430(2005). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis |
Subcellular Location |
Cytoplasm |
Protein Families |
EIF-3 subunit M family |
Tissue Specificity |
Broadly expressed. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.