« Back
Home /
Recombinant Human Eukaryotic translation initiation factor 3 subunit M(EIF3M)

Recombinant Human Eukaryotic translation initiation factor 3 subunit M(EIF3M)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP745333HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Others
Target / Protein	EIF3M
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q7L2H7
AA Sequence	SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEG GLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLL LILEPDKQEALIESLCEKLVKFREGERPSLRLQLL SNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIP TELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCK KSDAASKVMVELLGSYTEDNASQARVDAHRCIVRA LKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVS AKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLT FMGMAVENKEISFDTMQQELQIGADDVEAFVIDAV RTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLY DTLNAWKQNLNKVKNSLLSLSDT
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	2-374aa
Protein length	Full Length of Mature Protein
MW	58.4 kDa
Alternative Name(s)	Short name: eIF3m Alternative name(s): Fetal lung protein B5 Short name: hFL-B5 PCI domain-containing protein 1
Relevance	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).
References	"A new class of receptor for herpes simplex virus has heptad repeat motifs that are common to membrane fusion proteins."Perez A., Li Q.-X., Perez-Romero P., DeLassus G., Lopez S.R., Sutter S., McLaren N., Fuller A.O.J. Virol. 79:7419-7430(2005).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis
Subcellular Location	Cytoplasm
Protein Families	EIF-3 subunit M family
Tissue Specificity	Broadly expressed.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time