« Back
Home /
Recombinant Human Lysine-specific demethylase 3B(KDM3B) ,partial

Recombinant Human Lysine-specific demethylase 3B(KDM3B) ,partial

Item no.	CSB-EP759174HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFV RPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAV NVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQR IHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQG QENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWA IVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSP EHVKHCFRLTQEFR
Protein Family	JHDM2 histone demethylase family
Citations	"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	JmjC domain-containing histone demethylation protein 2B; Jumonji domain-containing protein 1B; Nuclear protein 5qNCA
Available
Manufacturer - Targets	KDM3B
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	45.6 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.
Expression Region	1498-1721AA
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.
Subcellular Location	Nucleus
Tissue Specificity	Ubiquitous. Highly expressed in placenta, skeletal muscle, kidney, heart and liver.
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP759174HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer