« Back
Home /
Recombinant Mouse Sushi repeat-containing protein SRPX2(Srpx2)

Recombinant Mouse Sushi repeat-containing protein SRPX2(Srpx2)

Item no.	CSB-EP819154MO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPR WCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCD RGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPF ITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRI CMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPE KLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHF PEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPIL KPP
Citations	"Cloning and characterization of the sushi-repeat containing protein (SRP) as a novel interaction partner of Rh type C glycoprotein (RhCG)." Huang C.-H., Chen H., Peng J., Chen Y. Submitted (JUN-2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Targets	Srpx2
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	70.5 kDa
General Research Areas	Neuroscience
Relevance	Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.
Expression Region	26-468aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.
Subcellular Location	Secreted, Cytoplasm, Cell surface, Cell junction, synapse
Tissue Specificity	Expressed in angiogenic endothelial cells (at protein level).
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP819154MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer