« Back
Home /
Recombinant Pyrococcus furiosus Putative L-asparaginase(PF0142),partial

Recombinant Pyrococcus furiosus Putative L-asparaginase(PF0142),partial

Item no.	CSB-EP823641FHW-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVAIIVHGGAGTIRKEERIPKIIEGVREAVLTGWR ELKKGSALDAVEEAVKVLEDNPLFNAGTGSVLTLD GKVEMDAAIMRGKTLDAGAVAGIWGVKNPISVARK VMEKTDHVLLIGEGAVKFARLMGFPEYDPTTEERR KQWEELRKKLLETGEIRHWKKLSELIKEYPEVLRS
Protein Family	Ntn-hydrolase family
Citations	"Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences."Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., DiRuggiero J., Robb F.T.Genetics 152:1299-1305(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	L-asparagine amidohydrolase; Cleaved into the following 2 chains:; Putative L-asparaginase subunit alpha; Putative L-asparaginase subunit beta
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.5 kDa
Relevance	L-asparagine + H2O = L-aspartate + NH3.
Expression Region	1-175aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	PF0142
Sequence Info	Partial
Organism	Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP823641FHW-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer