« Back
Home /
Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe(LFNG)

Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe(LFNG)

Item no.	CSB-EP839868HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Adhesion Molecule Markers
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVV ITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHV DDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPI QAMERVSENKVRPVHFWFATGGAGFCISRGLALKM SPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVP LIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFEN KRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCP RTA
Protein Family	Glycosyltransferase 31 family
Citations	"Clock regulatory elements control cyclic expression of Lunatic fringe during somitogenesis." Cole S.E., Levorse J.M., Tilghman S.M., Vogt T.F. Dev. Cell 3:75-84(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.2 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Neuroscience
Relevance	Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Decreases the binding of JAGGED1 to NOTCH2 but not that of DELTA1. Essential mediator of somite segmentation and patterning
Expression Region	1-250aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-like domains resulting in inhibition of NOTCH1 activation by JAG1 and enhancement of NOTCH1 activation by DLL1 via an increase in its binding to DLL1 (By similarity). Decreases the binding of JAG1 to NOTCH2 but not that of DLL1
Subcellular Location	Golgi apparatus membrane, Single-pass type II membrane protein
Involvement in disease	Spondylocostal dysostosis 3, autosomal recessive (SCDO3)
Pathway	Notchsignalingpathway
Gene Names	LFNG
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP839868HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/6/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer