« Back
Home /
Recombinant Reston ebolavirus Nucleoprotein(NP),partial

Recombinant Reston ebolavirus Nucleoprotein(NP),partial

Item no.	CSB-EP841983RCI-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RPNLGSRQDDDNEIPFPGPISNNPDQDHLEDDPRD SRDTIIPNSAIDPEDGDFENYNGYHDDEVGTAGDL VLFDLDDHEDDNKAFELQDSSPQSQREIERERLIH PPPGNNKDDNRASDNNQQSADSEEQEGQYNRHRGP ERTTANRRLSPVHEEDTPIDQGDDDPSSPPPLESD DDDASSSQQDPDYTAVAPPAPVYRSAEAHEPPHKS SNEPAETSQLNEDPDIGQSKSMQKLGETYHHLLRT QGP
Protein Family	Filoviruses nucleoprotein family
Citations	"Genome structure of Ebola virus subtype Reston: differences among Ebola subtypes." Ikegami T., Calaor A.B., Miranda M.E., Niikura M., Saijo M., Kurane I., Yoshikawa Y., Morikawa S. Arch. Virol. 146:2021-2027(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nucleocapsid protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.3 kDa
General Research Areas	Microbiology
Relevance	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases
Expression Region	414-739aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases (By similarity).
Subcellular Location	Virion, Host cytoplasm
Gene Names	NP
Sequence Info	Partial
Organism	Reston ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola virus)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP841983RCI-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time