« Back
Home /
Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial(AADAT)

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial(AADAT)

Item no.	CSB-EP843276HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFG EEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPT IHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDN VLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD SLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPT GNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFN KFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFL TGP
Protein Family	Class-I pyridoxal-phosphate-dependent aminotransferase family
Citations	Crystal structure of human kynurenine aminotransferase II, a drug target for the treatment of schizophrenia.Rossi F., Garavaglia S., Montalbano V., Walsh M.A., Rizzi M.J. Biol. Chem. 283:3559-3566(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	2-aminoadipate aminotransferase2-aminoadipate transaminase (EC:2.6.1.39)Alpha-aminoadipate aminotransferase ;AadATKynurenine aminotransferase IIKynurenine--oxoglutarate aminotransferase IIKynurenine--oxoglutarate transaminase 2 (EC:2.6.1.7)Kynurenine--oxoglutarate transaminase II
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	60.2 kDa
General Research Areas	Signal Transduction
Relevance	Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
Expression Region	30-425aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
Subcellular Location	Mitochondrion
Tissue Specificity	Higher expression in the liver. Also found in heart, brain, kidney, pancreas, prostate, testis and ovary.
Gene Names	AADAT
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP843276HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time