« Back
Home /
Recombinant Mouse [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial (Pdk3),partial

Recombinant Mouse [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial (Pdk3),partial

Item no.	CSB-EP852852MO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	IEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLI NQHTLLFGGDTNPAHPKHIGSIDPTCNVADVVKDA YETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVV YVPSHLFHMLFELFKNSMRATVELHEDKKEGYPAV KTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMY STAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQG DLKLYSMEGVGTDAVIYLKALS
Protein Family	PDK/BCKDK protein kinase family
Citations	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pyruvate dehydrogenase kinase isoform 3;
Available
Manufacturer - Targets	Pdk3
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.3 kDa
General Research Areas	Signal Transduction
Relevance	Inhibits pyruvate dehydrogenase activity by phosphorylation of the E1 subunit PDHA1, and thereby regulates glucose metabolism and aerobic respiration. Can also phosphorylate PDHA2. Decreases glucose utilization and increases fat metabolism in response to prolonged fasting, and as adaptation to a high-fat diet. Plays a role in glucose homeostasis and in maintaining normal blood glucose levels in function of nutrient levels and under starvation. Plays a role in the generation of reactive oxygen species
Expression Region	131-362aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits pyruvate dehydrogenase activity by phosphorylation of the E1 subunit PDHA1, and thereby regulates glucose metabolism and aerobic respiration. Can also phosphorylate PDHA2. Decreases glucose utilization and increases fat metabolism in response to prolonged fasting, and as adaptation to a high-fat diet. Plays a role in glucose homeostasis and in maintaining normal blood glucose levels in function of nutrient levels and under starvation. Plays a role in the generation of reactive oxygen species (By similarity).
Subcellular Location	Mitochondrion matrix
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP852852MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer