« Back
Home /
Recombinant Mouse Platelet-derived growth factor D(Pdgfd)

Recombinant Mouse Platelet-derived growth factor D(Pdgfd)

Item no.	CSB-EP852889MO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TPQRASIKALRNANLRRDESNHLTDLYQREENIQV TSNGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQL SFDHQFGLEEAENDICRYDFVEVEEVSESSTVVRG RWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGF KIYYSFVEDFQPEAASETNWESVTSSFSGVSYHSP SITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQ DDLENLYLDTPHYRGRSYHDRKSKVDLDRLNDDVK RYS
Protein Family	PDGF/VEGF growth factor family
Citations	"PDGF D, a novel protease-activated growth factor."LaRochelle W.J., Jeffers M., McDonald W.F., Chillakuru R.A., Giese N.A., Lokker N.A., Sullivan C., Boldog F.L., Yang M., Vernet C., Burgess C.E., Fernandez E., Deegler L.L., Rittman B., Shimkets J., Shimkets R.A., Rothberg J.M., Lichenstein H.S.Nat. Cell Biol. 3:517-521(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Spinal cord-derived growth factor B; Short name:; SCDGF-B; Cleaved into the following 2 chains:; Platelet-derived growth factor D, latent form; Short name:; PDGFD latent form; Platelet-derived growth factor D, receptor-binding form; Short name:; PDGFD receptor-binding form
Available
Manufacturer - Targets	Pdgfd
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56.2 kDa
Relevance	Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing (By similarity). Has oncogenic potential and can induce tumor formation. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of Extracellular domain matrix.
Expression Region	24-370aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing (By similarity). Has oncogenic potential and can induce tumor formation. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.
Subcellular Location	Secreted
Tissue Specificity	Expressed at high levels in developing heart, lung, kidney and some muscle derivatives. Moderately expressed in liver, brain and testis. In the kidney, localized to glomerular mesangial cells and vascular smooth muscle cells. Up-regulated in areas of renal fibrosis. In mice with unilateral ureteral obstruction, expressed in interstitial cells at day 4, with an increased to maximal expression at day 14.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP852889MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time