« Back
Home /
Recombinant Mouse Beta-adrenergic receptor kinase 1(Grk2)

Recombinant Mouse Beta-adrenergic receptor kinase 1(Grk2)

Item no.	CSB-EP858153MO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Lymphatic System Cancer
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MADLEAVLADVSYLMAMEKSKATPAARASKKILLP EPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRD FCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRS REIFDSYIMKELLACSHPFSKNATEHVQGHLVKKQ VPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFC QWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRK ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSL VST
Protein Family	Protein kinase superfamily, AGC Ser/Thr protein kinase family, GPRK subfamily
Citations	"Cloning of GRK2 cDNA from S49 murine lymphoma cells."Hughes R.J., Anderson K.L., Kiel D., Insel P.A.Am. J. Physiol. 270:C885-C891(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	G-protein-coupled receptor kinase 2
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	95.6 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them.
Expression Region	1-689aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them.
Subcellular Location	Cytoplasm, Cell membrane
Gene Names	Grk2
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP858153MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 2/12/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer