Comparison

Recombinant Human Cytoplasmic domain polyadenylation element-binding protein 1(CPEB1)

Item no. CSB-EP861184HU-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRP WSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRS SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSA SKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPW DIT
Protein Family RRM CPEB family
Citations Identification and characterization of the gene encoding human Cytoplasmic domain polyadenylation element binding protein.Welk J.F., Charlesworth A., Smith G.D., MacNicol A.M.Gene 263:113-120(2001)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
69.6 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Sequence-specific RNA-binding protein that regulates mRNA Cytoplasmic domain polyadenylation and translation initiation during oocyte maturation, early development and at postsynapse sites of neurons. Binds to the Cytoplasmic domain polyadenylation elent (CPE), an uridine-rich sequence elent (consensus sequence 5'-UUUUUAU-3') within the mRNA 3'-UTR. In absence of phosphorylation and in association with TACC3 is also involved as a repressor of translation of CPE-containing mRNA; a repression that is relieved by phosphorylation or degradation . Involved in the transport of CPE-containing mRNA to dendrites; those mRNAs may be transported to dendrites in a translationally dormant form and translationally activated at synapses . Its interaction with APLP1 promotes local CPE-containing mRNA polyadenylation and translation activation . Induces the assbly of stress granules in the absence of stress.
Expression Region
1-486aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Sequence-specific RNA-binding protein that regulates mRNA cytoplasmic polyadenylation and translation initiation during oocyte maturation, early development and at postsynapse sites of neurons. Binds to the cytoplasmic polyadenylation element (CPE), an uridine-rich sequence element (consensus sequence 5'-UUUUUAU-3') within the mRNA 3'-UTR. RNA binding results in a clear conformational change analogous to the Venus fly trap mechanism
Subcellular Location
Cytoplasm, Nucleus, Cytoplasm, P-body, Cytoplasmic granule, Cell junction, synapse, Membrane, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density, Cell projection, dendrite
Tissue Specificity
Isoform 1 is expressed in immature oocytes, ovary, brain and heart. Isoform 2 is expressed in brain and heart. Isoform 3 and isoform 4 are expressed in brain. Expressed in breast tumors and several tumor cell lines.
Gene Names
CPEB1
Sequence Info
Full Length of isoform 4
Organism
Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close