« Back
Home /
Recombinant Mouse Interleukin-23 subunit alpha(Il23a),partial

Recombinant Mouse Interleukin-23 subunit alpha(Il23a),partial

Manufacturer	Cusabio
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Amount	1mg
Host	E.coli
Item no.	CSB-EP863641MO-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	Q9EQ14
Gene Names	Il23a
Organism	Mus musculus (Mouse)
AA Sequence	VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNL LREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCL QRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLH TSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPL LRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Expression Region	22-196
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	23.7 kDa
Alternative Name(s)	Short name: IL-23 subunit alpha Short name: IL-23-A Alternative name(s): Interleukin-23 subunit p19 Short name: IL-23p19
Relevance	Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Reference	"IL-23 is essential for T cell-mediated colitis and promotes inflammation via IL-17 and IL-6."Yen D., Cheung J., Scheerens H., Poulet F., McClanahan T.K., McKenzie B., Kleinschek M.A., Owyang A., Mattson J., Blumenschein W., Murphy E., Sathe M., Cua D.J., Kastelein R.A., Rennick D.M.J. Clin. Invest. 116:1310-1316(2006).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular Location	Secreted
Protein Families	IL-6 superfamily
Tissue Specificity	Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time