« Back
Home /
Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

Item no.	CSB-EP866201HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Glial Cell Markers
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDM GLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD
Protein Family	IL-1 family
Citations	Four new members expand the IL-1 superfamily.Smith D.E., Renshaw B.R., Ketchem R.R., Kubin M., Garka K.E., Sims J.E.J. Biol. Chem. 275:1169-1175(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FIL1 deltaIL-1-related protein 3 ,IL-1RP3Interleukin-1 HY1 ,IL-1HY1Interleukin-1 delta ,IL-1 deltaInterleukin-1 family member 5 ,IL-1F5Interleukin-1 receptor antagonist homolog 1 ,IL-1ra homolog 1Interleukin-1-like protein 1 ,IL-1L1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	33 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling syst that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 syst with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Expression Region	1-155aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Subcellular Location	Secreted
Tissue Specificity	Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Involvement in disease	Psoriasis 14, pustular (PSORS14)
Gene Names	IL36RN
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP866201HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 12/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer