Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP870830ALAE-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Others |
Target / Protein |
aroA |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Agrobacterium sp. (strain CP4) |
Uniprot ID |
Q9R4E4 |
AA Sequence |
MSHGASSRPATARKSSGLSGTVRIPGDKSISHRSF MFGGLASGETRITGLLEGEDVINTGKAMQAMGARI RKEGDTWIIDGVGNGGLLAPEAPLDFGNAATGCRL TMGLVGVYDFDSTFIGDASLTKRPMGRVLNPLREM GVQVKSEDGDRLPVTLRGPKTPTPITYRVPMASAQ VKSAVLLAGLNTPGITTVIEPIMTRDHTEKMLQGF GANLTVETDADGVRTIRLEGRGKLTGQVIDVPGDP SSTAFPLVAALLVPGSDVTILNVLMNPTRTGLILT LQEMGADIEVINPRLAGGEDVADLRVRSSTLKGVT VPEDRAPSMIDEYPILAVAAAFAEGATVMNGLEEL RVKESDRLSAVANGLKLNGVDCDEGETSLVVRGRP DGKGLGNASGAAVATHLDHRIAMSFLVMGLVSENP VTVDDATMIATSFPEFMDLMAGLGAKIELSDTKAA |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-455aa |
Protein length |
Full Length |
MW |
63.6 kDa |
Alternative Name(s) |
5-enolpyruvylshikimate-3-phosphate synthase Short name:EPSP synthase Short name:EPSPS |
Relevance |
Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate. |
References |
"The expressed protein in glyphosate-tolerant soybean, 5-enolpyruvylshikimate-3-phosphate synthase from Agrobacterium sp. strain CP4, is rapidly digested in vitro and is not toxic to acutely gavaged mice."Harrison L.A., Bailey M.R., Naylor M.W., Ream J.E., Hammond B.G., Nida D.L., Burnette B.L., Nickson T.E., Mitsky T.A., Taylor M.L., Fuchs R.L., Padgette S.R.J. Nutr. 126:728-740(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate. |
Subcellular Location |
Cytoplasm |
Protein Families |
EPSP synthase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.