« Back
Home /
Recombinant Agrobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase(aroA)

Recombinant Agrobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase(aroA)

Manufacturer	Cusabio
Category	Food Safety Allergenes Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP870830ALAE-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Others
Target / Protein	aroA
Biologically active	Not Test
Expression system	E.coli
Species of origin	Agrobacterium sp. (strain CP4)
Uniprot ID	Q9R4E4
AA Sequence	MSHGASSRPATARKSSGLSGTVRIPGDKSISHRSF MFGGLASGETRITGLLEGEDVINTGKAMQAMGARI RKEGDTWIIDGVGNGGLLAPEAPLDFGNAATGCRL TMGLVGVYDFDSTFIGDASLTKRPMGRVLNPLREM GVQVKSEDGDRLPVTLRGPKTPTPITYRVPMASAQ VKSAVLLAGLNTPGITTVIEPIMTRDHTEKMLQGF GANLTVETDADGVRTIRLEGRGKLTGQVIDVPGDP SSTAFPLVAALLVPGSDVTILNVLMNPTRTGLILT LQEMGADIEVINPRLAGGEDVADLRVRSSTLKGVT VPEDRAPSMIDEYPILAVAAAFAEGATVMNGLEEL RVKESDRLSAVANGLKLNGVDCDEGETSLVVRGRP DGKGLGNASGAAVATHLDHRIAMSFLVMGLVSENP VTVDDATMIATSFPEFMDLMAGLGAKIELSDTKAA
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-455aa
Protein length	Full Length
MW	63.6 kDa
Alternative Name(s)	5-enolpyruvylshikimate-3-phosphate synthase Short name:EPSP synthase Short name:EPSPS
Relevance	Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.
References	"The expressed protein in glyphosate-tolerant soybean, 5-enolpyruvylshikimate-3-phosphate synthase from Agrobacterium sp. strain CP4, is rapidly digested in vitro and is not toxic to acutely gavaged mice."Harrison L.A., Bailey M.R., Naylor M.W., Ream J.E., Hammond B.G., Nida D.L., Burnette B.L., Nickson T.E., Mitsky T.A., Taylor M.L., Fuchs R.L., Padgette S.R.J. Nutr. 126:728-740(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.
Subcellular Location	Cytoplasm
Protein Families	EPSP synthase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP870830ALAE-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time