« Back
Home /
Recombinant Human Cytochrome P450 4F11(CYP4F11),partial

Recombinant Human Cytochrome P450 4F11(CYP4F11),partial

Item no.	CSB-EP872539HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Drugs Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPTEE GMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDII RPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGD KWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDK WQRLASEGSARLDMFEHISLMTLDSLQKCVFSFES NCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLY YLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQG IDD
Protein Family	Cytochrome P450 family
Citations	The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	3-hydroxy fatty acids omega-hydroxylase CYP4F11Curated (EC:1.14.13.-Curated)Cytochrome P450 4F11 ;CYPIVF11
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	72.2 kDa
General Research Areas	Cardiovascular
Relevance	Omega-hydroxylase that oxidizes a variety of structurally unrelated compounds, including fatty acids and xenobiotics. Plays a key role in vitamin K catabolism by mediating omega-hydroxylation of vitamin K1 (phylloquinone), and menaquinone-4 (MK-4), a form of vitamin K2. Hydroxylation of phylloquinone and MK-4 probably regulates blood coagulation . Catalyzes omega-hydroxylation of 3-hydroxy fatty acids, such as 3-hydroxypalmitate, 3-hydroxyoleate, 3-hydroxyarachidonate, and 3-hydroxystearate . Oxidizes drugs such as erythromycin, benzphetamine, ethylmorphine, chlorpromazine and imipramine .
Expression Region	38-524aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Omega-hydroxylase that oxidizes a variety of structurally unrelated compounds, including fatty acids and xenobiotics. Plays a key role in vitamin K catabolism by mediating omega-hydroxylation of vitamin K1 (phylloquinone), and menaquinone-4 (MK-4), a form of vitamin K2. Hydroxylation of phylloquinone and MK-4 probably regulates blood coagulation
Subcellular Location	Microsome membrane, Single-pass membrane protein
Tissue Specificity	Expressed mainly in human liver, followed by kidney, heart, and skeletal muscle.
Gene Names	CYP4F11
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP872539HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer