Comparison

Recombinant Mouse UMP-CMP kinase(Cmpk1)

Item no. CSB-EP875274MO-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAG ELLRDERKNPDSQYGELIEKYIKEGKIVPVEITIS LLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWN KTMDGKADVSFVLFFDCNNEICIERCLERGKSSGR SDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKI DASKSVDEVFGEVVKIFDKEG
Protein Family Adenylate kinase family, UMP-CMP kinase subfamily
Citations "Lineage-specific biology revealed by a finished genome assembly of the mouse."Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Deoxycytidylate kinaseU; Short name:; CK; Short name:; dCMP kinase; Nucleoside-diphosphate kinase; Uridine monophosphate/cytidine monophosphate kinase; Short name:; UMP/CMP kinase; Short name:; UMP/CMP
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
26.2 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Expression Region
1-196aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Subcellular Location
Nucleus, Cytoplasm
Gene Names
Cmpk1
Sequence Info
Full Length
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close