« Back
Home /
Recombinant Human Probable tRNA N6-adenosine threonylcarbamoyltransferase(OSGEP)

Recombinant Human Probable tRNA N6-adenosine threonylcarbamoyltransferase(OSGEP)

Item no.	CSB-EP878842HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTP PGTGFLPGDTARHHRAVILDLLQEALTESGLTSQD IDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLV GVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIA YSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPS PGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSF IEDVAHRMLATGECTPEDLCFSLQETVFAMLVEIT ERA
Protein Family	KAE1 / TsaD family
Citations	"Sequencing analysis of a putative human O-sialoglycoprotein endopeptidase gene (OSGEP) and analysis of a bidirectional promoter between the OSGEP and APEX genes." Seki Y., Ikeda S., Kiyohara H., Ayabe H., Seki T., Matsui H. Gene 285:101-108(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	N6-L-threonylcarbamoyladenine synthase
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	63.4 kDa
Relevance	Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.
Expression Region	1-335aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Widely expressed at low level. Expressed in heart, placenta, liver, kidney, lung, brain, skeletal muscle and pancreas.
Involvement in disease	Galloway-Mowat syndrome 3 (GAMOS3)
Gene Names	OSGEP
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP878842HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer