« Back
Home /
Recombinant Human Glutaminase liver isoform, mitochondrial(GLS2)

Recombinant Human Glutaminase liver isoform, mitochondrial(GLS2)

Item no.	CSB-EP887058HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRE TPHSHQPQHQDHDSSESGMLSRLGDLLFYTIAEGQ ERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVV QESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVI PDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKS NPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPL TYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEE GIP
Protein Family	Glutaminase family
Citations	"Molecular cloning, sequencing and expression studies of the human breast cancer cell glutaminase."Gomez-Fabre P.M., Aledo J.C., del Castillo-Olivares A., Alonso F.J., Nunez de Castro I., Campos J.A., Marquez J.Biochem. J. 345:365-375(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	L-glutaminase; L-glutamine amidohydrolase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	80.7 kDa
General Research Areas	Metabolism
Relevance	Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
Expression Region	15-602aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
Subcellular Location	Mitochondrion
Tissue Specificity	Highly expressed in liver. Expressed in brain and pancreas. Not observed in heart, placenta, lung, skeletal muscle and kidney. Expression is significantly reduced in hepatocellular carcinomas.
Paythway	Glutamatergicsynapse
Gene Names	GLS2
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP887058HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time