Comparison

Recombinant Human ADP-ribosylation factor-like protein 6(ARL6)

Item no. CSB-EP887945HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINK LKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMS GQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAK EELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSV KVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDW LQDQIQTVKT
Protein Family Small GTPase superfamily, Arf family
Citations "Comparative genomic analysis identifies an ADP-ribosylation factor-like gene as the cause of Bardet-Biedl Syndrome (BBS3)."
Chiang A.P., Nishimura D., Searby C., Elbedour K., Carmi R., Ferguson A.L., Secrist J., Braun T., Casavant T., Stone E.M., Sheffield V.C.
Am. J. Hum. Genet. 75:475-484(2004)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Bardet-Biedl syndrome 3 protein
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
48 kDa
General Research Areas
Signal Transduction
Relevance
Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia. Together with BBS1, is necessary for correct trafficking of PKD1 to primary cilia. Together with the BBSome complex and LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. May regulate cilia assembly and disassembly and subsequent ciliary signaling events such as the Wnt signaling cascade. Isoform 2 may be required for proper retinal function and organization
Expression Region
1-186aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia
Subcellular Location
Cell projection, cilium membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, cilium axoneme, Cytoplasm, cytoskeleton, cilium basal body
Involvement in disease
Bardet-Biedl syndrome 3 (BBS3); Retinitis pigmentosa 55 (RP55)
Gene Names
ARL6
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close