Comparison

Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial(ISCU)

Item no. CSB-EP887955HU(A4)-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAAAGAFRLRRAASALLLRSPRLPARELSAPARLY HKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACG DVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLA TEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSM LAEDAIKAALADYKLKQEPKKGEAEKK
Protein Family NifU family
Citations "Distinct iron-sulfur cluster assembly complexes exist in the cytosol and mitochondria of human cells."
Tong W.-H., Rouault T.
EMBO J. 19:5692-5700(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias NifU-like N-terminal domain-containing protein,NifU-like protein
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
45.0 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Signal Transduction
Relevance
Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins. First, a [2Fe-2S] cluster is transiently assembled on the scaffold protein ISCU. In a second step, the cluster is released from ISCU, transferred to a glutaredoxin GLRX5, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISCU depends on the function of the cysteine desulfurase complex NFS1-LYRM4/ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH
Expression Region
1-167aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins
Subcellular Location
Isoform 1: Mitochondrion, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Nucleus
Tissue Specificity
Detected in heart, liver, skeletal muscle, brain, pancreas, kidney, lung and placenta.
Involvement in disease
Myopathy with exercise intolerance Swedish type (MEIS)
Gene Names
ISCU
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Delivery expected until 10/23/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close