Comparison

Recombinant Human Charged multivesicular body protein 4b(CHMP4B)

Item no. CSB-EP887976HU-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEML SKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKR KKRYEKQLAQIDGTLSTIEFQREALENANTNTEVL KNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQEL AEEISTAISKPVGFGEEFDEDELMAELEELEQEEL DKNLLEISGPETVPLPNVPSIALPSKPAKKKEEED DDMKELENWAGSM
Protein Family SNF7 family
Citations "The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting."
Katoh K., Shibata H., Suzuki H., Narai A., Ishidoh K., Kominami E., Yoshimori T., Maki M.
J. Biol. Chem. 278:39104-39113(2003)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Chromatin-modifying protein 4b
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
51.8 kDa
Relevance
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Plays a role in the endosomal sorting pathway. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4B filaments can promote or stabilize negative curvature and outward budding. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan
The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the budding of enveloped viruses (HIV-1 and other lentiviruses). Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release.
Expression Region
1-224aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released
Subcellular Location
Cytoplasm, cytosol, Late endosome membrane, Peripheral membrane protein, Midbody, Nucleus envelope
Tissue Specificity
Widely expressed. Expressed at higher level in heart and skeletal muscle. Also expressed in brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes.
Involvement in disease
Cataract 31, multiple types (CTRCT31)
Paythway
Necroptosis
Gene Names
CHMP4B
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close