Comparison

Recombinant Human Multiple inositol polyphosphate phosphatase 1(MINPP1)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 50ug
Host E.coli
Item no. CSB-EP891977HU-50
Conjugate/Tag GST
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
Q9UNW1
Gene Names
MINPP1
Organism
Homo sapiens (Human)
AA Sequence
SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPE APWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIR KLRQLHGLLQARGSRDGGASSTGSRDLGAALADWP LWYADWMDGQLVEKGRQDMRQLALRLASLFPALFS RENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPG LPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVE KNATALYHVEAFKTGPEMQNILKKVAATLQVPVND LNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDA KVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQ HLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSL MGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNL IFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQE TVSFYEDLKNHYKDILQSCQTSEECELARANSTSD EL
Expression Region
31-487aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
79.1 kDa
Alternative Name(s)
2, 3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ; 2, 3-BPG phosphataseInositol (1, 3, 4, 5)-tetrakisphosphate 3-phosphatase ; Ins(1, 3, 4, 5)P(4) 3-phosphatase
Relevance
Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2, 3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2, 3-bisphosphoglycerate (2, 3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification).
Reference
Complete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2, 3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2, 3-bisphosphoglycerate (2, 3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity).
Involvement in disease
Thyroid cancer, non-medullary, 2 (NMTC2)
Subcellular Location
Endoplasmic reticulum lumen
Protein Families
Histidine acid phosphatase family, MINPP1 subfamily
Tissue Specificity
Widely expressed with highest levels in kidney, liver and placenta.
Tag Information
N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close