« Back
Home /
Recombinant Schizosaccharomyces pombe L-saccharopine oxidase(fap2)

Recombinant Schizosaccharomyces pombe L-saccharopine oxidase(fap2)

Item no.	CSB-EP892561SXV-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	VELAKNHSFDNIIAIDAEPVPSSMSAANDINKIVR PEYADLKYMKLALEAMEKWRNDPELSSVYFECGRL STISKDPYRARFDEVAQRNLRKLLGDSALINLSSS EEIRKKYPSLFSNSPLRSDMQAVVNEHAGYANSAA SLKLLELKARELGVEFVFGKAGKFKKFVVNHSETD IDKNDNHVSVQTEDGTIYHADTILLAVGAYLNAYL NTSHRVCAKGLPVAHIQLTDEEFKTYKNMPIIFDP DCA
Protein Family	MSOX/MTOX family
Citations	"ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe." Matsuyama A., Arai R., Yashiroda Y., Shirai A., Kamata A., Sekido S., Kobayashi Y., Hashimoto A., Hamamoto M., Hiraoka Y., Horinouchi S., Yoshida M. Nat. Biotechnol. 24:841-847(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SPAC139.04c
Available
Manufacturer - Targets	fap2
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	52.2 kDa
Expression Region	19-433aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Secreted, Cytoplasm, Nucleus
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP892561SXV-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time