Comparison

Recombinant Mouse Acid ceramidase(Asah1),partial

Item no. CSB-EP895296MO-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag Myc, GST, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINL DLPPYKRWHELLAQKAPALRILVNSITSLVNTFVP SGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTG IPLGEIISFNIFYELFTM
Protein Family Acid ceramidase family
Citations "Cloning and characterization of the full-length cDNA and genomic sequences encoding murine acid ceramidase."Li C.-M., Hong S.-B., Kopal G., He X., Linke T., Hou W.-S., Koch J., Gatt S., Sandhoff K., Schuchman E.H.Genomics 50:267-274(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Acylsphingosine deacylase,N-acylsphingosine amidohydrolase
Available
Manufacturer - Conjugate / Tag
N-terminal 10XHis-GST-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43.8 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Signal Transduction
Relevance
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Expression Region
19-141aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Subcellular Location
Lysosome
Gene Names
Asah1
Sequence Info
Partial
Organism
Mus musculus (Mouse)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close