Comparison

Recombinant Human Mitochondrial ornithine transporter 1(SLC25A15)

Item no. CSB-EP897578HU-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKV KMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPA LIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLS DLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEM ETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSS TLLREVPGYFFFFGGYELSRSFFASGRSKDELGPV PLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGK QAG
Protein Family Mitochondrial carrier (TC 2.A.29) family
Citations "Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter."
Camacho J.A., Obie C., Biery B., Goodman B.K., Hu A., Almashanu S., Steel G., Casey R., Lombard M., Mitchell G.A., Valle D.
Nat. Genet. 22:151-158(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Solute carrier family 25 member 15
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
59.7 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Expression Region
1-301aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Subcellular Location
Mitochondrion inner membrane, Multi-pass membrane protein
Tissue Specificity
Highly expressed in liver, pancreas, testis, lung and small intestine. Lower levels are detected in spleen, kidney, brain and heart.
Involvement in disease
Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)
Gene Names
SLC25A15
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close