« Back
Home /
Recombinant Human Annexin A2(ANXA2)

Recombinant Human Annexin A2(ANXA2)

Manufacturer	Cusabio
Category	Oncology Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Lipoprotein Receptors & Associated Proteins By Organ Bladder Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	Mammalian cells
Item no.	CSB-MP001840HU-100
Conjugate/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Signal Transduction
Uniprot ID	P07355
Gene Names	ANXA2
Organism	Homo sapiens (Human)
AA Sequence	STVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAE RDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDI AFAYQRRTKKELASALKSALSGHLETVILGLLKTP AQYDASELKASMKGLGTDEDSLIEIICSRTNQELQ EINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK GRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVP KWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRK EVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGK GTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLY YYIQQDTKGDYQKALLYLCGGDD
Expression Region	2-339aa
Sequence Info	Full Length of Mature Protein
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	42.5 kDa
Alternative Name(s)	Annexin II Annexin-2 Calpactin I heavy chain Calpactin-1 heavy chain Chromobindin-8 Lipocortin II Placental anticoagulant protein IV Short name: PAP-IV Protein I p36
Relevance	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9 (PubMed:18799458, PubMed:24808179, PubMed:22848640).
Reference	Two human 35KDA inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane, Melanosome
Protein Families	Annexin family
Tag Information	N-terminal 6xHis-Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP001840HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time