« Back
Home /
Recombinant Rat Complement factor D (Cfd)

Recombinant Rat Complement factor D (Cfd)

Item no.	CSB-MP005271RA-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Specific against	other
Host	Mammalian cells
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQW VLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHL YDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPH VRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPD VLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESN RRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRK PGVFTRVATYVPWIENVLSGNVSVNVTA
Protein Family	Peptidase S1 family
Citations	"Purification and partial characterization of rat factor D."Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adipsin,C3 convertase activator,Endogenous vascular elastase,Properdin factor D
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.8 kDa
General Research Areas	Immunology
Relevance	Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Expression Region	26-263aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Subcellular Location	Secreted
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP005271RA-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer