« Back
Home /
Recombinant Mouse Clathrin light chain A(Clta)

Recombinant Mouse Clathrin light chain A(Clta)

Item no.	CSB-MP005591MO-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Category	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Conjugate/Tag	FLAG, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAF LAQQESEIAGIENDEAFAILDGGAPGRATRRAAGG PDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSE PESIRKWREEQTERLEALDANSRKQEAEWKEKAIK ELEEWYARQDEQLQKTKANNRVADEAFYKQPFADL IGYVAAEEAFVNDIDESSPGTEWERVARLCDFNPK SSKQAKDVSRMRSVLISLKQAPLVH
Protein Family	Clathrin light chain family
Citations	SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged and Flag-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	31.1 kDa
Relevance	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.
Expression Region	1-235aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge (By similarity).
Subcellular Location	Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, spindle
Gene Names	Clta
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP005591MO-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer