« Back
Home /
Recombinant Human Glucagon-like peptide 1 receptor(GLP1R),partial

Recombinant Human Glucagon-like peptide 1 receptor(GLP1R),partial

Item no.	CSB-MP009514HU-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Mammalian cells
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPAT DLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE SKRGERSSPEEQLLFLY
Protein Family	G-protein coupled receptor 2 family
Citations	Genome-wide discovery and analysis of human seven transmembrane helix receptor genes.Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.Submitted (JUL-2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLP-1 receptor,GLP-1-R,GLP-1R
Available
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	18.3 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Neuroscience
Relevance	This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Expression Region	24-145aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Pathway	cAMPsignalingpathway
Gene Names	GLP1R
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP009514HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer